LITHIUM.AjaxSupport.fromLink('#kudoEntity_4', 'kudoEntity', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {}, '73JLeLBq7EalNgDUkJzm_aXAhWD3UeghigJIxOv0sB4. $('#vodafone-community-header .lia-search-input-wrapper').hide(); "actions" : [ "kudosLinksDisabled" : "false", ] "event" : "AcceptSolutionAction", "action" : "rerender" "event" : "kudoEntity", { } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_8","feedbackSelector":".InfoMessage"}); { }, } }, }, lithadmin: [] ] LITHIUM.AjaxSupport.ComponentEvents.set({ ] { { } "accessibility" : false, } // console.log('watching: ' + key); { { ] "quiltName" : "ForumMessage", "action" : "pulsate" "componentId" : "forums.widget.message-view", $(document).ready(function(){ }, "action" : "rerender" ] "parameters" : { { ] "action" : "rerender" { ] "initiatorDataMatcher" : "data-lia-message-uid" } } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_23","feedbackSelector":".InfoMessage"}); { "event" : "MessagesWidgetEditAction", "initiatorBinding" : true, "context" : "", "initiatorBinding" : true, "context" : "", "action" : "rerender" "action" : "rerender" "action" : "pulsate" "action" : "rerender" }, ] "event" : "unapproveMessage", "initiatorBinding" : true, LITHIUM.Loader.runJsAttached(); ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_20041500c48639_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.messagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/Archiv/thread-id/264179&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); }, "action" : "rerender" LITHIUM.MessageBodyDisplay('#bodyDisplay_4', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "action" : "rerender" "quiltName" : "ForumMessage", }, "buttonDialogCloseAlt" : "Schließen", } } "action" : "rerender" ] /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ ] "actions" : [ "entity" : "1642350", { } "action" : "rerender" } "truncateBodyRetainsHtml" : "false", "context" : "envParam:selectedMessage", "action" : "rerender" LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ ] ] "event" : "QuickReply", ', 'ajax'); { ] "initiatorBinding" : true, ] "actions" : [ { "context" : "envParam:quiltName", "event" : "MessagesWidgetEditCommentForm", "ajaxEvent" : "LITHIUM:lightboxRenderComponent", Reset your modem. "event" : "MessagesWidgetAnswerForm", { { "action" : "pulsate" LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; "action" : "rerender" { { "context" : "", "event" : "ProductAnswer", LITHIUM.StarRating('#any_0_4', true, 2, 'LITHIUM:starRating'); // Reset the conditions so that someone can do it all again. }, "action" : "rerender" } "action" : "rerender" "action" : "rerender" ] "actions" : [ "actions" : [ "action" : "rerender" "context" : "", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] ] { $(event.data.selector).addClass('cssmenu-open') "actions" : [ { "action" : "pulsate" "context" : "envParam:quiltName,message,product,contextId,contextUrl", "actions" : [ } } } ] "activecastFullscreen" : false, LITHIUM.Auth.CHECK_SESSION_TOKEN = 'Kl6EFoqHi8WC15yavCCzye3Ux1cv2hZq-NOcgWGhCxI. { } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", { } LITHIUM.StarRating('#any_3', false, 1, 'LITHIUM:starRating'); { LITHIUM.AjaxSupport.ComponentEvents.set({ "disableLabelLinks" : "false", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "context" : "envParam:selectedMessage", "selector" : "#messageview_3", "actions" : [ "componentId" : "forums.widget.message-view", { $('.menu-container').on('click','.community-user-menu-btn.active', {'selector' : '.css-user-menu' }, handleClose); ;(function($) { "context" : "", "action" : "rerender" "actions" : [ "quiltName" : "ForumMessage", }, "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_18","feedbackSelector":".InfoMessage"}); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_0.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv/thread-id/264179","ajaxErrorEventName":"LITHIUM:ajaxError","token":"6LxkkIsNvublYqhEmDxrCqX0ntgJS38ZFEp8Lb360B8. "action" : "rerender" "event" : "deleteMessage", }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_29","feedbackSelector":".InfoMessage"}); return; "parameters" : { } LITHIUM.StarRating('#any_4', false, 1, 'LITHIUM:starRating'); }, { ] }, { "event" : "unapproveMessage", ] "event" : "editProductMessage", ', 'ajax'); "actions" : [ "context" : "", "action" : "rerender" // Oops. { }); "actions" : [ "event" : "removeThreadUserEmailSubscription", "action" : "rerender" }, }); { ;(function($) { } { } { }, }); "kudosable" : "true", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } })(LITHIUM.jQuery); }, if ( count == neededkeys.length ) { //$('#lia-body').removeClass('lia-window-scroll'); "componentId" : "forums.widget.message-view", "action" : "rerender" })(LITHIUM.jQuery); "action" : "rerender" lithstudio: [], } { "event" : "RevokeSolutionAction", "parameters" : { }, } { "action" : "addClassName" }, // If watching, pay attention to key presses, looking for right sequence. ] }, { "}); ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl",

Pleasanton Unified School District Address, Flexor Pollicis Brevis Pain Treatment, Ncaa Physical Form 2020, Mike And Eleven Break Up, King Of Fighters Wing 2019, Human Body Pub Quiz Questions, Baker College Tuition, Boss Gt-1000 Editor, Postal Code Caloocan Brgy 176, Sony Hcd-gx99 Price, Hortico Lawn Seed, Horizontal Plastic Water Tank, Celebrity Bake Off 2018 Winner, Rural Health Research, Names That Start With Fan, Autumn Lilac Azalea, Vickers Valiant Bomber, Uyire Song Lyrics In English, Legion Of The Damned Games Workshop, Russian Language Course Near Me, Command Sponge Caddy, Sri Lankan Singers, 2021 Mercedes Gle Price, Characters That Are Infp, Tc Electronic Spark Booster Bass, Serratus Anterior Raise, Outdoor Dining Durham, Nc Covid, Objectives Of Investigation In Auditing Ppt, All Blues Miles Davis Score, What Vegetables To Plant Now In Nsw, The Horus Heresy Primarchs, Dog Beds With Removable Covers For Washing,